PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002692.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 360aa    MW: 40880 Da    PI: 7.2436
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002692.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.1e-49441692128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg
  Itr_sc002692.1_g00001.1  44 MPGFRFHPTEEELVEFYLRRKVEGKPFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATG 128
                              79***************************.89***************8778899******************************** PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               d+ + s++ + +glkktLvfy+g+apkg +t+W+m+eyrl
  Itr_sc002692.1_g00001.1 129 ADRMIRSENFRSIGLKKTLVFYTGKAPKGIRTSWIMNEYRL 169
                              ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-5642189IPR003441NAC domain
PROSITE profilePS5100555.82243190IPR003441NAC domain
PfamPF023656.0E-2545169IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MAIVPSRMSQ QDESSNTTNN NNNNHRRHEE DDEETDDHEH DVVMPGFRFH PTEEELVEFY  60
LRRKVEGKPF NVELITFLDL YRYDPWELPA LAAIGEKEWF FYVPRDRKYR NGDRPNRVTT  120
SGYWKATGAD RMIRSENFRS IGLKKTLVFY TGKAPKGIRT SWIMNEYRLP HHDTERLQKA  180
EISLCRVYKR AGVEDHPSLP RSLPTARATP SACRPPPHAA KKPPHHSLPP FEFPRTTANM  240
EAAATSLVLS QPTNSMNSYT PAPPAPPLAA VVASEEEKLL LTSPVVFPGG SSSPAAPFAD  300
DLHRLVNLHQ AATPQHFLTP QFSPLQLQPP LTFPDRLWDW SSLAPPPEQN KDYGASNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-55331907165NAC domain-containing protein 19
4dul_A2e-55331907165NAC domain-containing protein 19
1ut7_B2e-55331907165NO APICAL MERISTEM PROTEIN
1ut7_A2e-55331907165NO APICAL MERISTEM PROTEIN
1ut4_B2e-55331907165NO APICAL MERISTEM PROTEIN
1ut4_A2e-55331907165NO APICAL MERISTEM PROTEIN
3swp_D3e-553319010168NAC domain-containing protein 19
3swp_C3e-553319010168NAC domain-containing protein 19
3swp_B3e-553319010168NAC domain-containing protein 19
3swp_A3e-553319010168NAC domain-containing protein 19
3swm_D3e-553319010168NAC domain-containing protein 19
3swm_C3e-553319010168NAC domain-containing protein 19
3swm_B3e-553319010168NAC domain-containing protein 19
3swm_A3e-553319010168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626107.11e-135PREDICTED: transcription factor JUNGBRUNNEN 1-like isoform X1
TrEMBLA0A0M5JHG91e-139A0A0M5JHG9_MANES; NAC transcription factors 10
STRINGGLYMA17G00650.21e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-110NAC domain containing protein 35